Breaking
[CLAVICULAR]Fitness influencer Clavicular says he started taking testosterone at 14, calls natural training 'a waste'[BAXTER COUNTY]Woman with severe mental problems sitting in jail cell waiting on treatment[MEDICAID]Democratic senator proposes expanding Medicaid to cover children[UNIQUEPHARMACEUTICAL]Allergy medication recalled over potentially ‘life-threatening’ cross-contamination[FRIENDS OF BIG BEAR VALLEY]Rescued Big Bear bald eagle Jackie is ‘stable,’ wildlife nonprofit says[CLAVICULAR]Fitness influencer Clavicular says he started taking testosterone at 14, calls natural training 'a waste'[BAXTER COUNTY]Woman with severe mental problems sitting in jail cell waiting on treatment[MEDICAID]Democratic senator proposes expanding Medicaid to cover children[UNIQUEPHARMACEUTICAL]Allergy medication recalled over potentially ‘life-threatening’ cross-contamination[FRIENDS OF BIG BEAR VALLEY]Rescued Big Bear bald eagle Jackie is ‘stable,’ wildlife nonprofit says

Medication

8 stories

AllUNIQUEPHARMACEUTICALNOVONORDISKELILILLYAMGENFDAMERCKHEALTHPHARMACEUTICALSTGMCENVIRONMENT CANADAAKSTONPHARMACYTELANGANA DCAIMHDEAMHRAAMBLEPLASTICSURGERYAKSTON BIOSCIENCESTLCFFXNOWLIPFENDRAHSCPREP4ALLMEDSCAPEGSKFRACTYLHEALTHTRUMPRXTELEHEALTHGLENMARKMEDICAREEUROPEAN COMMISSIONHMSACVSCAR EMARKONCOLOGYKETABONPHARMACEUTICALLUPINLEQEMBIASCENSIONSAHPRAKENVUE
A person holds a single white pill and a glass of water, representing the new oral medication for cholesterol management.
MERCK11h ago

FDA Approves New Pill That Lowers Cholesterol Levels By Nearly 60%

The FDA recently approved Lipfendra, a new daily pill designed to treat high LDL cholesterol. This approval marks a significant shift in cardiovascular care as it represents the first PCSK9 inhibitor available in oral fo…

Merck logo displayed on a pharmaceutical laboratory background during a press announcement regarding the FDA approval.
2d ago

FDA Approves First-of-Its-Kind Cholesterol Pill, Ushering In New Wave of Treatment

A clinical close-up of the new Lipfendra medication pill and a heart health medical chart.
3d ago

FDA approves new pill to lower cholesterol levels

Merck medication packaging for Lipfendra, a newly FDA-approved daily cholesterol-lowering tablet.
3d ago

FDA approves breakthrough daily pill for cholesterol

More Stories
A clinical close-up of the newly approved cholesterol-lowering pill, Lipfendra, produced by Merck.
MERCK · 4d ago

What is the new FDA-approved pill designed to slash cholesterol levels?

The Food and Drug Administration has approved a new daily pill, Lipfendra, to lower cholesterol levels. Developed by Merck, the drug works by inhibiting the PCSK9 protein. This mec…

Merck branding on the packaging for Lipfendra, a new FDA-approved pill to lower LDL cholesterol in adults.
MERCK · 4d ago

FDA approves 1st-of-its-kind pill to reduce cholesterol

The Food and Drug Administration approved a new oral medication called Lipfendra. This drug provides a daily option for patients who need to lower their LDL cholesterol levels. Mer…

A clinical close-up of the newly approved cholesterol medication Lipfendra in its medical packaging.
MERCK · 4d ago

FDA approves first daily pill to drastically lower cholesterol levels

The FDA has granted approval for Lipfendra, a new once-daily oral medication designed to lower cholesterol. Produced by Merck, this pill is the first of its kind to inhibit the pro…

A Merck scientist works in a laboratory setting conducting research on cardiovascular medication development.
MERCK · 4d ago

FDA approves new kind of cholesterol pill

The Food and Drug Administration has officially approved Lipfendra, a new cholesterol-lowering medication from Merck. This daily pill belongs to the PCSK9 inhibitor class, offering…

← BACK TO ALL HEALTH NEWS